SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902183|ref|YP_004161911.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902183|ref|YP_004161911.1|
Domain Number 1 Region: 13-165
Classification Level Classification E-value
Superfamily Nudix 1.96e-19
Family BT0354 N-terminal domain-like 0.00061
Further Details:      
 
Domain Number 2 Region: 173-240
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.67e-18
Family Nudix-associated domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319902183|ref|YP_004161911.1|
Sequence length 243
Comment NUDIX hydrolase [Bacteroides helcogenes P 36-108]
Sequence
MQDIDYRTPLANNHISVDCVVIGFDGEQLKVLLIKRAGEEEGEVFHDMKLPGSLIYMDED
LDEAAKRVLNELTGLKNVNLIQFKAFGSKNRTKDPKDVHWLERAMQSKVERIVTIAYLSL
VKIDRTLSRDLDNYQACWIAMHDIRALAFDHNLIIKEAMIYIRQYVDINPSSLFDLLPRK
FTVSQLRTLYELVYGRKIDVRNFHKKIAFMEYVVPLEEKQQGVAHRAARYYRFDKKIYNK
IRR
Download sequence
Identical sequences E6SU52
WP_013547915.1.62754 gi|319902183|ref|YP_004161911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]