SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902370|ref|YP_004162098.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902370|ref|YP_004162098.1|
Domain Number 1 Region: 71-470
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.63e-70
Family (Uracil-5-)-methyltransferase 0.00048
Further Details:      
 
Domain Number 2 Region: 11-63
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000002
Family TRAM domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319902370|ref|YP_004162098.1|
Sequence length 475
Comment 23S rRNA m(5)U-1939 methyltransferase [Bacteroides helcogenes P 36-108]
Sequence
MARKRKELPLLEKVTITDVAAEGKAIAKVNDLVIFVPYVVPGDIVDLQIKRKKHHYAEAE
AVKFHEYSSVRAVPFCQHYGVCGGCKWQVLPYSEQIKYKQKQVTDNLIRIGKIELPEISP
ILGSEKTQFYRNKLEYTFSNKRWLTNAEIQQNVVYEQMNAVGFHIPNAFDKVLAIEKCWL
QDDISNRIRNAVRDYAYEHDYSFINLRTQEGMLRNMIVRTSTTGELMVILICKIEKDEEM
ELFKQLLQYVADTFPEITSLLYIINNKCNDTITDLDVYTFKGKDHIFEEMEGLRFKVGPK
SFYQTNSEQAYNLYKIARNFAGLTGDELVYDLYTGTGTIANFVSGKARRVIGIEYVPEAI
EDAKVNAEINGIKNTLFFAGDMKDMLTQDFINQYGRPDVIITDPPRAGMHQDVVDVILFA
EPKRIVYVSCNPATQARDLQLLDVKYKVKAVQPVDMFPHTHHVENVVLLELKANH
Download sequence
Identical sequences E6SVS3
gi|319902370|ref|YP_004162098.1| WP_013548100.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]