SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902432|ref|YP_004162160.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902432|ref|YP_004162160.1|
Domain Number 1 Region: 104-178,206-278
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.52e-33
Family Ferredoxin reductase FAD-binding domain-like 0.0095
Further Details:      
 
Domain Number 2 Region: 267-418
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.23e-30
Family Aromatic dioxygenase reductase-like 0.061
Further Details:      
 
Domain Number 3 Region: 40-122
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.85e-21
Family 2Fe-2S ferredoxin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319902432|ref|YP_004162160.1|
Sequence length 422
Comment NADH:ubiquinone oxidoreductase, subunit F [Bacteroides helcogenes P 36-108]
Sequence
MNMILASIGVFLVVILLLVVILLVAKQILVPSGNVKLTINGEKDLDVASGSTLLNTLSVN
GVFLSSACGGKGSCGQCKCQVLEGGGEILPSEVPHFSRKQQKDHWRLGCQVKVKGDMAIK
VPESVLGVKEWECEVISNKNVATFIKEFIVALPKGEHMDFVPGSYAQIKIPKYSMDYNKD
IDKSLIGDEYLPAWEKFGLFGLKCTNTEDTIRAYSMANYPAEGDRIMLTVRIATPPFKPR
EQGPGFQDVMPGIASSYIFTLKPGDKVIMSGPYGDFHPLFDSKKEMMWVGGGAGMAPLRA
QIMHMTKTLKTTDRKMSYFYGARALNEVFYLEDFLQIEKDFPNFSFHLALDRPDPAADAA
GVKYTPGFVHNVIYETYLKDHEAPEDIEYYMCGPGPMSKAVEKMLDDLGVPAQNLMFDNF
GG
Download sequence
Identical sequences E6SVY5
gi|319902432|ref|YP_004162160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]