SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902565|ref|YP_004162293.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902565|ref|YP_004162293.1|
Domain Number 1 Region: 5-309
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 2.22e-106
Family Tex N-terminal region-like 0.00000165
Further Details:      
 
Domain Number 2 Region: 310-455
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.04e-47
Family Tex RuvX-like domain-like 0.0000214
Further Details:      
 
Domain Number 3 Region: 456-544
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.11e-29
Family Tex HhH-containing domain-like 0.00031
Further Details:      
 
Domain Number 4 Region: 546-617
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.33e-20
Family Tex HhH-containing domain-like 0.00042
Further Details:      
 
Domain Number 5 Region: 622-706
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.27e-20
Family Cold shock DNA-binding domain-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319902565|ref|YP_004162293.1|
Sequence length 713
Comment Tex-like protein [Bacteroides helcogenes P 36-108]
Sequence
MIQLFHRMISDTLGISERQVNQTLELLNNGATIPFISRYRKEVTGGLDEVQIEAIQTQYE
KLNETAKRKETILSTIQEQGKLTDELRKRIDETWENTTLEDIYLPYKPKRKTRAEAARQK
GLEPLADLLRLQQEDNPEACASAFVKGDVKSVEEALQGARDIMAERISEDSEVRKCARYS
FDHWGTLNAKVINGKEEEAAKYRDYFDCHEPLKKCSSHRLLAIRRGETEGLLRVSITSDD
ENTLERLQRRFQRHRNACSQHIGLAVEDAYKRLVRPAIETEFANQSKERADEEAIRVFAE
NLRQLLLAPPLGQKRVMGIDPGFRTGCKVVCLDAQGNLLHNENIYPHPPVNKGKEAFSKL
QKMMEAYKIDAIAIGNGTASRETEDFLKRQSFNREVQVFIVSEQGASIYSASKIARDEFP
EYDVTVRGAVSIGRRLMDPLAELVKIDPKSIGVGQYQHDVDQTKLKKSLDQTVENCVNLV
GVNLNTASSHLLTYISGLGPQLAQNIVNYRAENGAFTSRKELMKVPRMGAKAFEQCAGFL
RIPDAKNPLDNTAVHPESYCIVEQMAKDLECSVAELISNKELRLKINPERYLSPTVGMPT
LKDILQELDKPGRDPRGPIKMFEFDRNVRTINDLREGMELPGIVGNITNFGAFVDIGIKE
NGLIHLSQLAERFISDPNKVVSIHQHLRVKVLSIDIARKRIQLTLIGVEQERY
Download sequence
Identical sequences E6SN54
WP_013548294.1.62754 gi|319902565|ref|YP_004162293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]