SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|319902666|ref|YP_004162394.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902666|ref|YP_004162394.1|
Domain Number 1 Region: 23-241
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.49e-54
Family PFOR PP module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319902666|ref|YP_004162394.1|
Sequence length 253
Comment thiamine pyrophosphate TPP-binding domain-containing protein [Bacteroides helcogenes P 36-108]
Sequence
MTKEDIIKPENLVAKKPTLMNDNPMHYCPGCSHGVVHKLIAEVIEEMGLEDKAIGISPVG
CAVFIYNYIDIDWQEAAHGRAPALATAIKRLWPDRLVFTYQGDGDLACIGTAETIHALNR
GENITIIFINNAIYGMTGGQMAPTTLVGMKTSTSPYGRDVHLHGYPLKMADIAAQLEGTA
YVTRQSVQTVPAIRKAKKAIRKAFENSMAGKGSNLVEIVSTCNSGWKMSPEKSNTWMEEH
MFPFYPLGDLKDK
Download sequence
Identical sequences E6SNS5
gi|319902666|ref|YP_004162394.1| WP_013548395.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]