SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902743|ref|YP_004162471.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902743|ref|YP_004162471.1|
Domain Number 1 Region: 39-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000533
Family Cold shock DNA-binding domain-like 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|319902743|ref|YP_004162471.1|
Domain Number - Region: 439-497
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 0.0334
Family Poly(A) polymerase, PAP, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319902743|ref|YP_004162471.1|
Sequence length 524
Comment ribonuclease, Rne/Rng family [Bacteroides helcogenes P 36-108]
Sequence
MTSELVVDVQPKEVSIALLEDKQLVELQSEGRSLYFSVGNMYLGRIKKLMPGLNACFVDV
GYEKDAFLHYLDLGPQFNSLEKYVKQTLSDKKKLNPITKATILPDLEKDGTVSNTLKVGQ
EVVVQIVKEPISTKGPRLTSELSFAGRYLVLIPFNDKVSVSQKIKSSEERARLKQLLMSI
KPKNFGVIVRTVAEGKRVAELDGELKVLLKHWEDAITKVQKATKFPTLIYEETSRAVGLL
RDLFNPSFESIHVNDEAVYHEIKDYVTLIAPERADIVKLYKGQLPIYDNFGITKQIKSSF
GKTISYKSGAYLIIEHTEALHVVDVNSGNRTKNANGQEGNALEVNLGAADELARQLRLRD
MGGIIVVDFIDMNEAENRQKLYERMCQNMQKDRARHNILPLSKFGLMQITRQRVRPAMDV
NTTETCPTCFGKGTIKSSILFTDTLESKIDYLVNKLKIKKFSLHIHPYIAAYINQGIVSL
KRKWQMKYGFGIKIIPSQKLAFLEYVFYDPHGEEIDMKEEIEIK
Download sequence
Identical sequences E6SPC8
gi|319902743|ref|YP_004162471.1| WP_013548472.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]