SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902799|ref|YP_004162527.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902799|ref|YP_004162527.1|
Domain Number 1 Region: 3-395
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.44e-111
Family Homocysteine S-methyltransferase 0.00000608
Further Details:      
 
Domain Number 2 Region: 352-626
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 7.06e-83
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0011
Further Details:      
 
Domain Number 3 Region: 748-899
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 9.94e-45
Family Cobalamin (vitamin B12)-binding domain 0.00000491
Further Details:      
 
Domain Number 4 Region: 660-744
Classification Level Classification E-value
Superfamily Methionine synthase domain 2.35e-25
Family Methionine synthase domain 0.0000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319902799|ref|YP_004162527.1|
Sequence length 921
Comment methionine synthase (B12-dependent) [Bacteroides helcogenes P 36-108]
Sequence
MASIEKIVHERILILDGAMGTMIQQYNLEEKDFRGERFSDIQGQLKGNNDLLCLTRPDVI
QDIHRKYLAAGADIIETNTFNSTRVSMADYHVQEYVREINFAAVRLAREIADEFTSLTPD
KPRFVAGSVGPTNKTCSMSPDVNNPAFRALTYDELAADYCEQMEALLQGGVDALLIETIF
DTLNAKAAIWAAEQAMKATGKHVPLMLSVTVSDTAGRTLSGQTLEAFLASVQHADIFSVG
LNCSFGARQLKPFLEQFACRAPYYISAYPNAGLPNSLGKYDQTPADMAHEIREYIREGLV
NIIGGCCGTTDAYIAEYSALVAGVVPHVPASAPDNLWLSGLELLEVKPENNFVNVGERCN
VAGSRKFLRLINEKKYDEALSIARQQVEDGAQVIDINMDDGLLDARAEMTTFLNLVASEP
EIARVPVMIDSSKWEVIVAGLKCLQGKSIVNSISLKEGEENFLEHARTVREYGAAAVVMA
FDEKGQADTYERKIEVCERAYRLLVDKVKFNPHDIIFDPNILAVATGMDEHNNYAVDFIN
AVGWIRKNLPGAHVSGGVSNLSFSFRGNNYIREAMHAVFLYYAIREGMDMGIVNPATSVL
YTDIPADILERLEDVVLNRRPDAAERLIETAERLKAEADAAKASGTGNVQPVNSQLSWRE
NSTVEDRLKYALTKGIIDYLDEDLAQALEQYPKAVDIIEGPLMAGMNHVGDLFGAGKMFL
PQVVKTARTMKKAVAILQPVIESERKEDSTSAGRVLLATVKGDVHDIGKNIVSVVMACNG
YEIIDLGVMVPAETIVQHAIEEKVDMIGLSGLITPSLDEMVHVAIELEKAGLDIPLLIGG
ATTSQLHTALKIASVYHAPVIHLKDASQNATVAARLMNPKQKEELVEDLSTKYRQLREKN
GERQVSTVSLEEAKKNKLNLF
Download sequence
Identical sequences E6SPW2
gi|319902799|ref|YP_004162527.1| WP_013548528.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]