SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902922|ref|YP_004162650.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902922|ref|YP_004162650.1|
Domain Number 1 Region: 3-197
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.79e-44
Family ETFP subunits 0.019
Further Details:      
 
Domain Number 2 Region: 214-332
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.46e-43
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319902922|ref|YP_004162650.1|
Sequence length 339
Comment Electron transfer flavoprotein alpha subunit [Bacteroides helcogenes P 36-108]
Sequence
MNNVFVYLEIEGTTVADVSLELLTKGRKLANQLGCQLEAIAVGNNLTDIEKQVLPFGVDK
LHLFDAPGLFPYTSLPHSSVLINLFKEEKPQICLMGATVIGRDLGPRVSSALTSGLTADC
TSLEIGDHEDKKEGKVYENLLYQIRPAFGGNIVATIVNPEHRPQMATVREGVMKKEILDA
NYKGEVINHDVAKYVPETDYVVKVIDRHVEAAKHNLKGAPIVIAGGYGMGSKEGFNMLFE
LAKELHAEVGASRAAVDAGYADHDRQIGQTGVTVRPKLYIACGISGQIQHIAGMQESGII
ISVNNDENAPINTIADYVINGTVEEVIPKMIKYYKAHSK
Download sequence
Identical sequences E6SQZ5
gi|319902922|ref|YP_004162650.1| WP_013548651.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]