SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319903005|ref|YP_004162733.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319903005|ref|YP_004162733.1|
Domain Number 1 Region: 64-132
Classification Level Classification E-value
Superfamily RuvA domain 2-like 4.73e-19
Family DNA helicase RuvA subunit, middle domain 0.003
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000314
Family DNA helicase RuvA subunit, N-terminal domain 0.0033
Further Details:      
 
Domain Number 3 Region: 153-200
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.00000000000314
Family DNA helicase RuvA subunit, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319903005|ref|YP_004162733.1|
Sequence length 200
Comment Holliday junction DNA helicase subunit RuvA [Bacteroides helcogenes P 36-108]
Sequence
MIEYIKGEIAELSPATAVIDCNGLGYAVNISLNTYAAVQGKKECKLYIYEAIREDAYILY
GFADKQERELFLLLISVSGIGGNTARMILSALSPSELINVISTENANLLKSVKGIGLKTA
QRVIVDLKDKIKTDSVATGSAGDMTSLLMAANTQVQEEAVAALTMLGFAQAPSQKVVLAI
LKENPNAPVEQVIKLALKRL
Download sequence
Identical sequences E6SRQ7
WP_013548734.1.62754 gi|319903005|ref|YP_004162733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]