SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319903096|ref|YP_004162824.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319903096|ref|YP_004162824.1|
Domain Number 1 Region: 6-522
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.7e-154
Family Aconitase iron-sulfur domain 0.0000000000312
Further Details:      
 
Domain Number 2 Region: 527-743
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 8.44e-60
Family LeuD-like 0.000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319903096|ref|YP_004162824.1|
Sequence length 745
Comment aconitase [Bacteroides helcogenes P 36-108]
Sequence
MVYDLAMLKAFYADYAKKIECVRAVLGHPLTLAEKILYVHLYKEVKRYKRGEDYVNFRPD
RVAMQDATAQMALLQFMNAGREQVAVPSTVHCDHLIQAYKGAEEDIATATNTNKEVYDFL
RDVSSRYGIGFWQPGAGIIHQVVLENYAFPGGMMVGTDSHTPNAGGLGMIAIGVGGADAV
DVMTGMEWELKMPRLIGVHLTGKLSGWAAPKDVILKLAGILTVKGATNAIIEYFGPGTEC
LSATGKATICNMGAEVGATTSLFPYDERMAAYLKATGREEVAAMADAVAADLRPDDNVLA
NPEMHYDRIIEIDLSLLEPYINGPFTPDAATPISEFAEKVVLNDYPRKMEVGLIGSCTNS
SYQDLSRAASLARQVKMKGLSVAGTLIVNPGSEQIRSTAERDGMMGAFEEIGATIMANAC
GPCIGQWKRCTDSTERRNSIVTSFNRNFAKRADGNPNTYAYVASPELTMALTIAGDLCFN
PLKDTLVNDQGKRVMLSEPVGEELPLKGFSSGREGYIAPTGDRNDISVDPNSRRLQLLTP
FPAWDGADLLDMPLLIKVRGKCTTDHISMAGPWLRFRGHLENISENLLMGAVNAFNGETN
KVWNRLSNTYGTVSGTAGVYKSAGIPSIVVAEENYGEGSSREHAAMEPRFLNVRVILAKS
FARIHETNLKKQGMLALTFMDKADYDRIREHDLLSVVGLDDFVPGQNLKVVLQHEDGTKE
SFEVQHTYNEQQIIWFRAGSALNAR
Download sequence
Identical sequences E6ST34
WP_013548825.1.62754 gi|319903096|ref|YP_004162824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]