SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319903103|ref|YP_004162831.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319903103|ref|YP_004162831.1|
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-61
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000594
Further Details:      
 
Domain Number 2 Region: 369-562
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.25e-60
Family Pyruvate oxidase and decarboxylase PP module 0.00002
Further Details:      
 
Domain Number 3 Region: 189-347
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 6.75e-53
Family Pyruvate oxidase and decarboxylase, middle domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319903103|ref|YP_004162831.1|
Sequence length 564
Comment acetolactate synthase, large subunit [Bacteroides helcogenes P 36-108]
Sequence
MENLITGAEALMRSLEHQGVKTIFGYPGGSIMPVFDALYDHRKNLNHILVRHEQGAAHAA
QGFARVSGKVGVCLVTSGPGATNTITGIADAMIDSTPVVVIAGQAATAFLGTDAFQEVDL
VGITQPITKWSYQIRRAEDVAWAVARAFYIAKSGRPGPVVLDFAKNAQVDKTAYTPTLVD
YVRSYLPAPEMEPEAIRQAAELINAAERPLVLVGQGVELGNAQPELRAFIEKAGMPAGCT
LLGLSALPTEHPLNKGMLGMHGNLGPNINTNKCDVLIAVGMRFDDRVTGKLETYAKQAKI
IHFDIDPAEIDKNVKTTVAVLGDCKETLAAVTSLLKPATHKEWIDSFLPYEQIEEEKVIR
PELHPVGDKLSMGEVVRAVSEATRHEAILVTDVGQNQMMSARYFKYSKERSIVTSGGLGT
MGFGLPAAIGATFGRPDRTVCVFMGDGGLQMNLQELGTVMEQKAPVKMILLNNNFLGNVR
QWQAMFFNHRYSFTPMMNPDYLKIASAYDIPARRVFTRKELKQAIADMLAADGAFLLEAC
VEEEGNVMPMTPPGGSVNQMLLEC
Download sequence
Identical sequences E6ST41
gi|319903103|ref|YP_004162831.1| WP_013548832.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]