SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319903113|ref|YP_004162841.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319903113|ref|YP_004162841.1|
Domain Number 1 Region: 29-548
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-dependent enzymes 8.83e-217
Family Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain 0.00000000000242
Further Details:      
 
Domain Number 2 Region: 552-713
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 4.45e-59
Family Cobalamin (vitamin B12)-binding domain 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319903113|ref|YP_004162841.1|
Sequence length 715
Comment methylmalonyl-CoA mutase, large subunit [Bacteroides helcogenes P 36-108]
Sequence
MRKDFKNLDIYAAFKPANGAEWQKANGIHADWKTPEHIEVKPVYTKEDLEGMEHLGYAAG
LPPYLRGPYSVMYTLRPWTIRQYAGFSTAEESNAFYRRNLASGQKGLSVAFDLATHRGYD
PDHERVVGDVGKAGVSICSLENMKVLFDGIPLNKMSVSMTMNGAVLPVMAFYINAGLEQG
AKLEEMAGTIQNDILKEFMVRNTYIYPPAFSMKIISDIFEYTSQKMPKFNSISISGYHMQ
EAGATADIELAYTLADGLEYLRAGTAAGIDIDAFAPRLSFFWAIGTNHFMEIAKMRAARM
LWAKIVKQFNPKNPKSLALRTHSQTSGWSLTEQDPFNNVGRTCIEAMAAALGHTQSLHTN
ALDEAIALPTDFSARIARNTQIYIQEETYICKNVDPWGGSYYVESLTNELAHKAWELIQE
VEKLGGMAKAIETGIPKMRIEEAAARTQARIDSGSQTIVGVNKYRLEKEAPIDILEIDNT
AVRQEQIANLKTLKEGRDEAAVQKALEAITKCVETKEGNLLELAVEAARVRATLGEISYA
CEKIVGRYKAVIRTISGVYSSESKNDSDFRRACELAEKFAKKEGRQPRIMVAKMGQDGHD
RGAKVVATGYADCGFDVDMGPLFQTPAEAAREAVENDVHVVGVSSLAAGHKTLVPQIIEE
LKNLGREDIVVIAGGVIPAQDYDFLYKAGVAAIFGPGTPVAKAACQILEILLDEE
Download sequence
Identical sequences E6ST51
WP_013548842.1.62754 gi|319903113|ref|YP_004162841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]