SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319903114|ref|YP_004162842.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319903114|ref|YP_004162842.1|
Domain Number 1 Region: 6-537
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-dependent enzymes 5.23e-135
Family Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain 0.00000395
Further Details:      
 
Domain Number 2 Region: 485-629
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 3.66e-35
Family Cobalamin (vitamin B12)-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319903114|ref|YP_004162842.1|
Sequence length 632
Comment heterodimeric methylmalonyl-CoA mutase small subunit [Bacteroides helcogenes P 36-108]
Sequence
MADSKEKLFSDFSSISTEQWMEKVTADLKGADFEKKLVWKTNEGFKVKPFYRMEDLEGLR
ITDALPGEFPYLRGTKKSNNEWLVRQEIKVESPEEANAKALDILNKGIDSLSFHVKAKEL
SAEYIDTLLKDICAECVELNFSTCQGHVVGLAELLVAYFRKKDYDLTKLRGSINYDYFNK
MLAKGKEKGDMVATAKALIEATADLPKYRILNVNALTLNNAGAYIYQELGYALAWGNEYM
NQLTDAGLPAAMVAKKIKFNFGISSNYFLEIAKFRAARMLWANIVASYAPECLRDCENRG
DSKDCRCAAKMKIHAETSTFNLTLFDAHVNLLRTQTEAMSAALAGVDSMTVVPFDKTYAV
PDDFSERMARNQQLLLKEESHFDKVIDPAAGSYYIENLTVAIAEQAWKLFLTVEEDGGFY
TSVKAGKVQEAINESNKIRHKAVAQRREVLLGTNQFPNFNEKASDKKPVEDTCCCGGSHT
CEKDVATLNFDRAASEFEALRLETEASGKRPKAFMLTIGNLAMRQARAQYSCNFLACAGY
EVVDNLGFSTVEEGVEAAMAAKADIVVLCSSDDEYAEYAVPAFKALNNRAMFIVAGAPAC
MDELKAAGIENFIHVRVNVLETLKEFNAKLLK
Download sequence
Identical sequences E6ST52
WP_013548843.1.62754 gi|319903114|ref|YP_004162842.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]