SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319903118|ref|YP_004162846.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319903118|ref|YP_004162846.1|
Domain Number 1 Region: 161-499
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.01e-109
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000167
Further Details:      
 
Domain Number 2 Region: 5-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-35
Family Anticodon-binding domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319903118|ref|YP_004162846.1|
Sequence length 576
Comment lysyl-tRNA synthetase [Bacteroides helcogenes P 36-108]
Sequence
MNVLELSEQEIIRRNSMNELRAMGIEPYPAAEYVTNAFSTDIKTEFKDDEEPRQVSVAGR
MMSRRVMGKASFIELQDSKGRIQVYITRDDICSEEDKEMYNTVFKRLLDLGDFIGIEGFV
FRTQMGEISIHAKKLTVLAKSLKPLPIVKYKDGVAYDSFEDPELRYRQRYVDLIVNDGVK
ETFLKRSTIIKTLRAALDEAGYTEVETPILQSIAGGASARPFTTHHNSLDIDLYLRIATE
LYLKRLIVGGFEGVYEIGKNFRNEGMDKNHNPEFTCMELYVQYKDYNWMMSFTEKLLERI
CIAVNGCPETEIDGKTISFKAPYRRLPILEAIREKTGYDLEGKNEDEIRQVCKALKMEID
DTMGKGKLIDEIFGEFCEGTFIQPTFITDYPVEMSPLTKMHRSKPGLTERFELMVNGKEL
ANAYSELNDPIDQEERFKDQLKLSEKGDDEAMFIDQDFLKALQYGMPPTSGIGIGIDRLT
MLMTGKAFIQEVLFFPQMRPEKVTPKDTPAKFMELGIPETWIPVIQKAGYNLVSDMKDVN
PQKLHMDICDINKKYKLELTAPTVNEVANWISSIKN
Download sequence
Identical sequences E6ST56
WP_013548847.1.62754 gi|319903118|ref|YP_004162846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]