SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900436|ref|YP_004160164.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900436|ref|YP_004160164.1|
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily ACP-like 8.11e-24
Family Acyl-carrier protein (ACP) 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319900436|ref|YP_004160164.1|
Sequence length 78
Comment ACP [Bacteroides helcogenes P 36-108]
Sequence
MSEIASRVKAIIVDKLGVEESEVTTEASFTNDLGADSLDTVELIMEFEKEFGISIPDDQA
EKIGTVGDAVSYIEEHAK
Download sequence
Identical sequences A0A0J9FMM3 A0A174G4G6 A0A174GUS3 A0A1C5REU0 A0A1C7H4F8 A0A1G8D110 A0A1Q6G1V7 A5ZF84 C3Q977 D0TMY4 D4VHB3 D6CZU9 D7J0I1 E5CA10 E6SW53 F3PWJ0 F7M2Q0 I8UXD0 I8YUC2 I9AC66 I9H424 U6RUB8
WP_002558672.1.12560 WP_002558672.1.18195 WP_002558672.1.19864 WP_002558672.1.20771 WP_002558672.1.26154 WP_002558672.1.26971 WP_002558672.1.29459 WP_002558672.1.31445 WP_002558672.1.32410 WP_002558672.1.33241 WP_002558672.1.34924 WP_002558672.1.36583 WP_002558672.1.4322 WP_002558672.1.44254 WP_002558672.1.45558 WP_002558672.1.54168 WP_002558672.1.59392 WP_002558672.1.610 WP_002558672.1.62754 WP_002558672.1.66863 WP_002558672.1.70665 WP_002558672.1.72730 WP_002558672.1.72754 WP_002558672.1.72775 WP_002558672.1.73642 WP_002558672.1.82909 WP_002558672.1.86418 WP_002558672.1.87028 WP_002558672.1.88358 WP_002558672.1.9287 WP_002558672.1.9313 WP_002558672.1.93978 WP_002558672.1.94328 WP_002558672.1.95559 WP_002558672.1.98721 gi|479164548|ref|YP_007793282.1| gi|319900436|ref|YP_004160164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]