SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900803|ref|YP_004160531.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900803|ref|YP_004160531.1|
Domain Number 1 Region: 112-211,238-479
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.19e-77
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000878
Further Details:      
 
Domain Number 2 Region: 481-605
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 9.81e-31
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00033
Further Details:      
 
Domain Number 3 Region: 9-98
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0000000000392
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319900803|ref|YP_004160531.1|
Sequence length 605
Comment arginyl-tRNA synthetase [Bacteroides helcogenes P 36-108]
Sequence
MNIEQKLVTSVISGLKALYGQDVPAAQVQLQKTKKEFEGHLTLVVFPFLRLSRKGPEQTA
QEIGEYLLANEPSVAAFNVIKGFLNLTVASSAWIELLNGIHAESSYGIVPVTDKSPLVMI
EYSSPNTNKPLHLGHVRNNLLGNALANIVAANGNKVVKTNIVNDRGIHICKSMLAWQKYG
GGETPETSGKKGDHLIGDYYVAFDKHYKAEVKELMSEFRDEGMSEEEAKAKAEAESPLMK
EAREMLVRWEANDPEVRALWKKMNDWVYAGFDETYKMMGVTFDKIYYESNTYLEGKEKVM
EGLEKGFFYRKEDGSVWADLTGEGLDHKLLLRADGTSVYMTQDIGTAKLRFADYPIDKMI
YVVGNEQNYHFQVLSILLDKLGFEWGKGLVHFSYGMVELPEGKMKSREGTVVDADDLMAE
MIETAKETSDELGKLDGLTKEEADNIARIVGLGALKYFILKVDARKNMTFNPKESIDFNG
NTGPFIQYTYARIQSVLRKAKEAGIEIPARLPDGIELSEKEEGLIQMIADFASVVKQAGE
DYSPSVIANYTYDLVKEYNQFYHDFSILREENEALKVFRLALSENVAKVVRLGMGLLGIE
VPDRM
Download sequence
Identical sequences E6SQ40
gi|319900803|ref|YP_004160531.1| WP_013546558.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]