SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319901198|ref|YP_004160926.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|319901198|ref|YP_004160926.1|
Domain Number - Region: 237-338
Classification Level Classification E-value
Superfamily Nudix 0.0127
Family IPP isomerase-like 0.03
Further Details:      
 
Domain Number - Region: 147-249
Classification Level Classification E-value
Superfamily YojJ-like 0.0837
Family YojJ-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319901198|ref|YP_004160926.1|
Sequence length 372
Comment hypothetical protein Bache_1334 [Bacteroides helcogenes P 36-108]
Sequence
MGHQRVLSSKFNMSLGFIPVIISILLCEFMTQDISIYIGSGVGLLLYFCSRRHKGVYIPP
IILYSTTGMLLLLSITAFFTTSPCPSFLFPFTLEISATIPPIAIYLNRKRFLDYHTAQTG
QCCKQLFAQAAEAAIVSARVVLIISFLHLIIIFLTVLISYPLGNTTRYILFNIAPPAVFI
LCIIFNQFGIFYFNIVMRHTVFVPIVNTKGDVTGKAIASEAINKKNEFINPVIRIAVASH
GMLFLLPRPQCSVLEGGKTDLLIEGYLLYGETLEQGAGRILRQTLPTALTSDLYFNLMYH
FENEKTNRLNYLFTLDLDDDSVLCNKTFKGGKLWTLQQIEHNLGKEFFSHCFECEYEHLK
AIICTREKYRES
Download sequence
Identical sequences E6SUH6
gi|319901198|ref|YP_004160926.1| WP_013546934.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]