SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902382|ref|YP_004162110.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902382|ref|YP_004162110.1|
Domain Number 1 Region: 1-238,993-1133
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.3e-22
Family ABC transporter ATPase domain-like 0.0059
Further Details:      
 
Domain Number 2 Region: 517-607
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0000235
Family Rad50 coiled-coil Zn hook 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319902382|ref|YP_004162110.1|
Sequence length 1139
Comment hypothetical protein Bache_2566 [Bacteroides helcogenes P 36-108]
Sequence
MRLQKLTIKNLASIEDAVIDFENGPLKEESLFLICGETGAGKTTLLDAICLALYNETPRM
DRTAGERYKDTAQAFSNKKEDILINDNRQLMRRNTCEAWAELDFIGTNDTPYTARWYVAR
ARKKADGALQDVKWTLENRKSHLQLTKKTEIPNEIQAAIGLTFEQFCRTTLLAQGDFTKF
LQSKESEKSDILEKLTGTEIYSQTGARIYAVTKEKRTDYENQNRKLEGIRLLTEKEIAEA
GRAMAAQETEIKGLNIQKSMALQKRDWLRKNAELAIASENQKKVWEEKNVLLESDDFRLK
EQLVNDWHTTTDARNWLVLLNKNRVELQKEEERSFELKTDFTRLCNGYARLKADTEKQHE
ELLRVEEYLQKYAPLLPMFEQSQSIIAGLLSVLSAQERADGYEKDISVLNKMQPLREEER
AAKEKIFLLKSKENQQKQEEISRHKAKLDAMQLYALQEKRTSLEAGKEIFLKTKTALTLL
KEKQWALKTAEEQEQSFDSRMTACQAQYNRLLTDLNHKKEVYGDIRKLYDKQKEAVEDWA
KEARTRLAIGDTCPVCGQEIKSLRHDEDFQSILVPIRISLETKEKEYKEAEQTLGNNRTE
FKTYEKETLRCRLVTEQARENYHRALKDAKDKCARCGIQDISDSTESALDTLIQNNSRSL
EALNTKLNEAQALADVISGLQRQKDGLQMSVETARNELNAADKNLSELKNNIANKHSLIK
NEKDTIHAAIQHITPLILWQEWQTEWNARPTFFIERLKQAAARYRQAQSKQAELKTAIAL
NNKEQESISTAKENICSAFPDWKDTAVEETGQAGNLEIAWNSLSVQAVRLKQSMLSIRNA
IKELQNKLSEFYNIHPDFDEARLASLAAYSREQIEQLRTRLQQLKEEIASRRTAYRLTCE
QAEAHLKLKPKMDEDDTSESLDIQILECEQQITERNQVIGQLQALLTQHEQNIALIKNEK
KHADELRDIYLKWDRLCSHFGDEKGKNFRNIAQSFVLKELLNGANFYLQRLTDRYELECQ
AGSLTILLRDFYQGGVARPACTLSGGESFLVSLSLALGLSSLNRQSLSVDTLFIDEGFGT
LSGDYLNTVMDTLEKLHRMGGKKVGIISHVEGLKERIKTQIQVKRIDNSRSEIRTVKMI
Download sequence
Identical sequences E6SVT5
WP_013548112.1.62754 gi|319902382|ref|YP_004162110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]