SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902459|ref|YP_004162187.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902459|ref|YP_004162187.1|
Domain Number 1 Region: 67-129,172-202,257-314
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00000965
Family Sir2 family of transcriptional regulators 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319902459|ref|YP_004162187.1|
Sequence length 393
Comment hypothetical protein Bache_2648 [Bacteroides helcogenes P 36-108]
Sequence
MRLDLLKNIIQSSHINFLFGSGLSNPYLSTLGNIETWLTEAEQIEEVDTKNIIKTSLEAY
YFSTVMNPCLYSEISLLNEDRKKHYDSVINNYKSFLSRWNEIMAKRNVSLLDKQVNIFTT
NIDNLVETAAEEVKVEFNDGFKGRITPIFSEDTFSNITSKVSPLYQNQSMIPVFNYMKIH
GSVNWKAIESNDISIDTELKILQEIADLYKCLTPSDVIFDFGDCTNIEDIKKKAEDIIEC
EDYESDKRGQFSDLFSKLVMVRPRKNKFSETVLELHFYELMRLYSNALECSNSLLIVAGF
SFADEHIAKITVRAANSNPTLQILVFAYDDFSKKLIETNINKAGARNNNNILYITPESFK
HSQDADFANKSLKDLTKFDLESINKYVFGYIGI
Download sequence
Identical sequences E6SWE0
WP_013548188.1.62754 gi|319902459|ref|YP_004162187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]