SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15668322|ref|NP_247118.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15668322|ref|NP_247118.1|
Domain Number 1 Region: 31-166
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 8.89e-34
Family MJ1460-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15668322|ref|NP_247118.1|
Sequence length 173
Comment hypothetical protein MJ_0150 [Methanocaldococcus jannaschii DSM 2661]
Sequence
MGDVKMDKELLHKKIKKDIEDLINNHPPERTLGNLIPLSIFQAVRIGVLTAGCGIEAIIY
NIGKDIGREVISRYVDRDNLLESFAEILKKAKIGILEVKKVEENEMILILKDCISCHNVP
NVGTTLCHFEAGLIAGTLEKKLRRKVNAVETKCCGKGDEYCEFLVKIEDKLYW
Download sequence
Identical sequences Q57614
gi|15668322|ref|NP_247118.1| 243232.MJ0150 368084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]