SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15669045|ref|NP_247849.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15669045|ref|NP_247849.1|
Domain Number 1 Region: 78-222
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.46e-33
Family MJ1460-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15669045|ref|NP_247849.1|
Sequence length 228
Comment hypothetical protein MJ_0855 [Methanocaldococcus jannaschii DSM 2661]
Sequence
MTNAMKIIEMLRIIDNRAKFMGIKLTMMKNLLEKYKDNKELLKEVLKLTEGTRLHELILE
AYPPLEELKKEIREEEHKIKITSESGGEEKKEFCTFEGPVSLIAYIKEYLRKYYLGNNVK
RIFYDIGKDYAIKLGINTYDDMITFMKKDFGEVVIEKSEPLTVVVKDNKECKNCKASEPI
CYLTAGFIAGCLENMTNKTYIVEVTEEKCQAVGDPYCTFVAKKSIRLD
Download sequence
Identical sequences Q58265
WP_010870369.1.84152 243232.MJ0855 gi|15669045|ref|NP_247849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]