SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15669275|ref|NP_248080.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15669275|ref|NP_248080.1|
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.35e-41
Family GHMP Kinase, N-terminal domain 0.0000000161
Further Details:      
 
Domain Number 2 Region: 184-306
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 9.05e-29
Family Mevalonate kinase 0.00000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15669275|ref|NP_248080.1|
Sequence length 312
Comment mevalonate kinase [Methanocaldococcus jannaschii DSM 2661]
Sequence
MIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLN
EIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTI
KAVSGFYNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEFE
EFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLM
TKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELLKELNK
EDVRIFNCRMMN
Download sequence
Identical sequences Q58487
NYSGXRC-T580 WP_010870599.1.84152 243232.MJ1087 gi|15669275|ref|NP_248080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]