SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15669292|ref|NP_248097.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15669292|ref|NP_248097.1|
Domain Number 1 Region: 169-299
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.39e-37
Family Homoserine kinase 0.000000329
Further Details:      
 
Domain Number 2 Region: 5-164
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.38e-35
Family GHMP Kinase, N-terminal domain 0.0000000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15669292|ref|NP_248097.1|
Sequence length 300
Comment homoserine kinase [Methanocaldococcus jannaschii DSM 2661]
Sequence
MREIMKVRVKAPCTSANLGVGFDVFGLCLKEPYDVIEVEAIDDKEIIIEVDDKNIPTDPD
KNVAGIVAKKMIDDFNIGKGVKITIKKGVKAGSGLGSSAASSAGTAYAINELFKLNLDKL
KLVDYASYGELASSGAKHADNVAPAIFGGFTMVTNYEPLEVLHIPIDFKLDILIAIPNIS
INTKEAREILPKAVGLKDLVNNVGKACGMVYALYNKDKSLFGRYMMSDKVIEPVRGKLIP
NYFKIKEEVKDKVYGITISGSGPSIIAFPKEEFIDEVENILRDYYENTIRTEVGKGVEVV
Download sequence
Identical sequences gi|15669292|ref|NP_248097.1| 243232.MJ1104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]