SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15669631|ref|NP_248444.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15669631|ref|NP_248444.1|
Domain Number 1 Region: 5-158
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.81e-23
Family GHMP Kinase, N-terminal domain 0.0037
Further Details:      
 
Domain Number 2 Region: 225-281
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000000046
Family Homoserine kinase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15669631|ref|NP_248444.1|
Sequence length 282
Comment shikimate kinase [Methanocaldococcus jannaschii DSM 2661]
Sequence
MEGKAYALASGTIINAIATGKGSAFGLDLKVYAKVKLIDDGKNKIEGKVLDNPNIKPNLI
VRCVKNTLDYFGLNYSAYVETKTEIPIKSGLSSSSATSNAVVLATFDALGEKIDDELILN
LGIKSSFDEKLTVTGAYDDATASYYGGITITDNIERKILKRDKMRDDLNVLILIPNLEKN
VDVNRMKLIKDYVEIAFNEAINGNYFKALFLNGILYASALNFPTNIAIDALDAGAITAGL
SGTGPSYIAMVEDENVEKVKEKLNRYGKVILTKPNNDGASIY
Download sequence
Identical sequences Q58835
gi|15669631|ref|NP_248444.1| 243232.MJ1440 WP_010870958.1.84152 NYSGXRC-T586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]