SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568132781|ref|YP_008928786.1| from Ehrlichia muris AS145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568132781|ref|YP_008928786.1|
Domain Number 1 Region: 33-340
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3e-72
Family Phosphate binding protein-like 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568132781|ref|YP_008928786.1|
Sequence length 347
Comment iron deficiency-induced protein A [Ehrlichia muris AS145]
Sequence
MIRLITCFSIIAVIMLAFNFFTKRQQVQNSGQEVRVYSSRKEELLHSLFEQFTKETGINV
QYINDEAAQLINRMENEGTATSADVFLTADAVNLILAKKNGLLQPVQSEVLNQAIPSKYR
DSDGFWFGLTKRARVIVYNKDVIEESELSTYEYLANTKWKDKILIRSSSSPYNQSLIAFM
IANNGIENTKIWIKGLVSNMARKPSGGDIDQIYAVAADEGSIAIVNSYYFGRIAASNKKS
DQAAVKKLGIFFPNQETTGTMINISGGAVTKHAKNKQNAIRLLEFLASVKAQRVYAQVNQ
EYPVVEGVEISDVLKTFGVFKESNLPLQELEEHLTESVKIADECGWR
Download sequence
Identical sequences V9R6M4
gi|568132781|ref|YP_008928786.1| WP_024071762.1.18368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]