SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568132803|ref|YP_008928808.1| from Ehrlichia muris AS145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568132803|ref|YP_008928808.1|
Domain Number 1 Region: 22-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.56e-56
Family Phosphate binding protein-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568132803|ref|YP_008928808.1|
Sequence length 340
Comment phosphate ABC transporter substrate-binding protein [Ehrlichia muris AS145]
Sequence
MGRFLLLFLLLIILAFNSNAQQIRVVGSSTAFPFISAIAEEFGRFSDYETPIIESVGSGM
GFSMFCQGAGKNTPDIVMSSRKIKDAELKLCESNNINNITELIIGYDGIVIASSKDRDKL
DFTKKDLFKALSKYSTSNEYTETIALNNFRYWSEVNNRFPNIDIEVYGPYKNTGTYNILI
EEIMQDACITNQNFIDVYPEFTKRQRICGVMRNDGKYIEVAANENIIIQKIAKNPDAFGI
LSFSFLVKNQDKIHANKIAGIEPNYETISSGEYVLSRPIYLYIKQEHINLSPGLKEFIKI
ILREDSIGKNGYLIGLGFIPLSDKDLEDNKNRIISTLEKQ
Download sequence
Identical sequences V9R5I5
WP_024071784.1.18368 gi|568132803|ref|YP_008928808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]