SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333987020|ref|YP_004519627.1| from Methanobacterium sp. SWAN-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333987020|ref|YP_004519627.1|
Domain Number 1 Region: 14-86
Classification Level Classification E-value
Superfamily Homeodomain-like 1.61e-19
Family Tetracyclin repressor-like, N-terminal domain 0.0051
Further Details:      
 
Weak hits

Sequence:  gi|333987020|ref|YP_004519627.1|
Domain Number - Region: 88-143
Classification Level Classification E-value
Superfamily AF0941-like 0.0248
Family AF0941-like 0.0049
Further Details:      
 
Domain Number - Region: 159-211
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0409
Family Tetracyclin repressor-like, C-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333987020|ref|YP_004519627.1|
Sequence length 251
Comment TetR family transcriptional regulator [Methanobacterium sp. SWAN-1]
Sequence
MYVLVAGEFMSSVSRREREREQRRNDITVAAEKLFFSKGYDGVSMNDIAKEAELSKATLY
LYFDNKEALFFSIVLRGTIILNEIIKQEISKFEKGIEKLGALLDAYFEFAQNYPDYLKIY
NYFQSGKFDLKNILTNDYMKKIISQSNGVVNIPFDFSNSDISYSNEVMKLQNEMFLTVYE
SVEIGMADGTICSDVDPTEIAVLVILITENILNMRPDLKNALEKQSIHQKKFVVDTIDLL
NQMLGNIKKSQ
Download sequence
Identical sequences F6D887
gi|333987020|ref|YP_004519627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]