SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333987077|ref|YP_004519684.1| from Methanobacterium sp. SWAN-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333987077|ref|YP_004519684.1|
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000133
Family Tetracyclin repressor-like, N-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 118-202
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000000381
Family Tetracyclin repressor-like, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333987077|ref|YP_004519684.1|
Sequence length 203
Comment TetR family transcriptional regulator [Methanobacterium sp. SWAN-1]
Sequence
METKVRIMETAFKLFLKKGFADVSLNEIIRESDITTGGFYYHFNSKDTLLVEVINKYIFN
YFSSTIEQMKECKGTPKQILKTVILLLVGDDSVINETTQLCEGAEKIDYRTLHLLLFEGV
QKYDIISEHYTEFYYNLFEFIKDVINDGISQGVIREDIDSTEISLTIETVMVGTVLMWIG
MPAISLEKRMEANMEQIWSSIKA
Download sequence
Identical sequences F6D1T0
WP_013825385.1.26247 gi|333987077|ref|YP_004519684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]