SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333987136|ref|YP_004519743.1| from Methanobacterium sp. SWAN-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333987136|ref|YP_004519743.1|
Domain Number 1 Region: 108-149
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000247
Family Tetracyclin repressor-like, N-terminal domain 0.073
Further Details:      
 
Domain Number 2 Region: 61-101
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000657
Family Recombinase DNA-binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333987136|ref|YP_004519743.1|
Sequence length 151
Comment hypothetical protein MSWAN_0917 [Methanobacterium sp. SWAN-1]
Sequence
MGNEIYVSEQLSSRKIMELLDKYPDLEKIRCPQSLYLRISKKYLEALSELGIEVEPVIRV
GRPKKYTEEPEAIQKLLDDGKSPKEISEILKIPLKTVYYLKNSKLKRGRKSKYPPETEEK
VKKLYEDGVPTREISQKLEIPLRTVYYFLKR
Download sequence
Identical sequences F6D2K8
WP_013825444.1.26247 gi|333987136|ref|YP_004519743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]