SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333987293|ref|YP_004519900.1| from Methanobacterium sp. SWAN-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333987293|ref|YP_004519900.1|
Domain Number 1 Region: 86-194
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 3.46e-18
Family Tetracyclin repressor-like, C-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 6-71
Classification Level Classification E-value
Superfamily Homeodomain-like 1.74e-16
Family Tetracyclin repressor-like, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333987293|ref|YP_004519900.1|
Sequence length 200
Comment TetR family transcriptional regulator [Methanobacterium sp. SWAN-1]
Sequence
MDEEINTRDRIVRAATRLFQLKGYHATGLNEILRESNAPKGSLYYYFPNGKEELALESIE
LTKVFVEETIRKRLSMIEDPAESIKNAIQEMADFIDMEENEKISFKSTKKVSVNLVALET
SSSNENLRKACESAFDAWQNVYAEKLIQGGFTRQEAQKLSMVIQSMIEGAIVMSLTKKSD
VPFFEVAETIPSILRLKNKN
Download sequence
Identical sequences F6D4A0
WP_013825601.1.26247 gi|333987293|ref|YP_004519900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]