SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333988005|ref|YP_004520612.1| from Methanobacterium sp. SWAN-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333988005|ref|YP_004520612.1|
Domain Number 1 Region: 196-302
Classification Level Classification E-value
Superfamily GlnB-like 1.37e-16
Family Prokaryotic signal transducing protein 0.00058
Further Details:      
 
Domain Number 2 Region: 3-150
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.39e-16
Family G proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333988005|ref|YP_004520612.1|
Sequence length 303
Comment nitrogen regulatory protein P-II [Methanobacterium sp. SWAN-1]
Sequence
MDNRNILIIGPPDSGKKTAVKHMHGEDLEIKSFAYGRAIINNKKNYLFSSTGKEGFKSLE
DVLMNDGTGTTGIIIVLDSARGITETDNEIIGLVSEKNIPYVLFSNKQDLNGTGLRTDIT
DAIVIPTIAAEGIGIQDGLKILLKQIERKNKHIDVKKSEYQYQKIYKSKRLSNGAANAIK
VYKNDLKSGKSEICKLKLIMHPIELDNVKEILEKRGFSNLTLTEIKCSEDQVNSMETYRA
SQYSVTLKPKVELSMIIAKKDAEYVIKAIESIKTDDIEDDMFIYPIERILRIRTSEEGEE
AID
Download sequence
Identical sequences F6D4E8
WP_013826310.1.26247 gi|333988005|ref|YP_004520612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]