SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333988216|ref|YP_004520823.1| from Methanobacterium sp. SWAN-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333988216|ref|YP_004520823.1|
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily GlnB-like 1.4e-29
Family Prokaryotic signal transducing protein 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333988216|ref|YP_004520823.1|
Sequence length 105
Comment nitrogen regulatory protein P-II [Methanobacterium sp. SWAN-1]
Sequence
MQMIRAIIRPEMAEKTVNKLDAAGYVALTKLDVIGRGKQKGIQLENIYYDEIPKTMLLLV
SEDEKTSEIVDIITESAITGNFGDGKIFVSPVDEVYTVRTRSKGL
Download sequence
Identical sequences F6D763
WP_013826521.1.26247 gi|333988216|ref|YP_004520823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]