SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333988365|ref|YP_004520972.1| from Methanobacterium sp. SWAN-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333988365|ref|YP_004520972.1|
Domain Number 1 Region: 11-73
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000112
Family Tetracyclin repressor-like, N-terminal domain 0.0077
Further Details:      
 
Domain Number 2 Region: 106-206
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000345
Family Tetracyclin repressor-like, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333988365|ref|YP_004520972.1|
Sequence length 210
Comment TetR family transcriptional regulator [Methanobacterium sp. SWAN-1]
Sequence
MTKTSSNKNGKISTKEKIFDVSVDLFSKKGFDAVSIREIAREVGIRESSIYNHYPSKETI
LNVIFQYFKKELTKMRPPEAVNIEKLTPDIFRERVHLTHMLFRTPTMEKIFKIIINEQFK
NEKARKIVLHNLIEEPHKFTEKVLDNMNQRGIIRPLDPKIMAVEFQYPIFSLFMEYLLLK
SNNLNTEDVETRLKSHVDFFLSVITPEVEK
Download sequence
Identical sequences F6D3Z4
gi|333988365|ref|YP_004520972.1| WP_013826670.1.26247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]