SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313203484|ref|YP_004042141.1| from Paludibacter propionicigenes WB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313203484|ref|YP_004042141.1|
Domain Number 1 Region: 244-457
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.68e-28
Family ABC transporter ATPase domain-like 0.00052
Further Details:      
 
Domain Number 2 Region: 22-231
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000000000445
Family DNA repair protein MutS, domain III 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313203484|ref|YP_004042141.1|
Sequence length 462
Comment DNA mismatch repair protein MutS domain-containing protein [Paludibacter propionicigenes WB4]
Sequence
MNVYRLGAEWDIKKIKMRFDTDRQTLSDLNIFPQERGIKSVFDYYNKTQTKGGKDLLLSI
MREPLNDLTEINSRIYSIKFLHDNDLYCVLERKDIDAIEYYLKLDKSVLKNHIIDSIYDY
YSNRVKPTNEYYLISRGINCLYKHVRNLIDFFENDDIPEFPGFLAEFKSEVDRIKYHPDF
NSFINKDRKKLNLRQINRFDHLIRKSEKETIVKVLEFTYMFDSYISLACVAKEQKLGFPT
LIETSNPKIKIEGFFHPLIENPVKNDINFSKDENLCFVSGANMAGKSTFLKSIGLCVYLS
HIGFPVPARTMLTPLFHGLYTTINISDNINKGYSHYYSEVKRVKDITLLIKERKRVFVIF
DELFRGTNVKDAFDATLMITRGFSRIKNSIFLISTHIVEVGKELEKSDSICFKCFESKLH
REKPVYNYILKDGLSSERLGLTIMKNEGILEMIDEIAENENK
Download sequence
Identical sequences E4T362
gi|313203484|ref|YP_004042141.1| WP_013444525.1.41328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]