SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313204088|ref|YP_004042745.1| from Paludibacter propionicigenes WB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313204088|ref|YP_004042745.1|
Domain Number 1 Region: 118-274
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0007
Further Details:      
 
Domain Number 2 Region: 389-548
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.93e-28
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00072
Further Details:      
 
Domain Number 3 Region: 7-116
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.24e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 
Domain Number 4 Region: 715-781
Classification Level Classification E-value
Superfamily SirA-like 1.83e-18
Family SirA-like 0.00077
Further Details:      
 
Domain Number 5 Region: 251-273,300-401
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0000000000000442
Family Duplicated SiR/NiR-like domains 1 and 3 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313204088|ref|YP_004042745.1|
Sequence length 787
Comment sulfite reductase (ferredoxin) [Paludibacter propionicigenes WB4]
Sequence
MYKLPTTLTEDIAYFGTLIDDFHQGKIEPVKFKGTRVPMGIYEQRKDGTYMVRVRCTGGY
ISPQQLKQVALTAQSHHSTLLHITTRQEIQIHHISIDQVKTILPELQKVELSSKGGGGNT
VRNFLVDVNSGISHTEVFDVLPYAVDLTTKLIAKPDSFSLPRKLKIAFSTSESKADFAVI
NDLGFIATIKDGKRGFKVYLGGSVASNPTLGWELFDFAPEEELINIAIAAKRFFNNHGNR
KNKHKARIRYIFYKEGEEKTKELFFNYYNEIKAKENVVYTPASLNFEYRNPSFAASDVHS
SEFELWKKQHASSQKQNGLFSTIVSFVNGNTDSETLLKIAGFASEFGNDVLRFTARQQLQ
LRNIPEKYLGNVYLLLKELNIPTELPVVIDNIVSCTGADTCRLGICYSKGASLALRKKLG
KSKLNLNEVSELQINISGCPNSCAQQIWSDIGFSGRVGRNERMYAAYNVYVGAQKGNNPQ
LGEAIGTVSAKDLPQFTEDILADYISVKVAHSSFRNYLDANGKDKIKSLVEKYKDIPDFD
EDKNYYYDWGSEELFSVANKGPAECSAGLFDMIDVDLNFIKQGFDSLKSETEANKINQIL
FDIVFSSARMLLVTKGAEPRITAEAFELFIDKFINEGLVDESFKDLVKIAQTNPDTDFST
RKEEIVSLSDAVIKLYEGMDDSLQFKVPSTKQIETQQENPVQEIKTTDVDIRVKDYRGVA
CPMNFVKTKIELATMKSGELLEIWLDDGQPIQNVPGSVRNEGHQVVSVIQEGLFWKVMIR
KKRFSFG
Download sequence
Identical sequences E4T4W6
gi|313204088|ref|YP_004042745.1| WP_013445129.1.41328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]