SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313204209|ref|YP_004042866.1| from Paludibacter propionicigenes WB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313204209|ref|YP_004042866.1|
Domain Number 1 Region: 268-565
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.58e-77
Family DNA repair protein MutS, domain III 0.0000022
Further Details:      
 
Domain Number 2 Region: 567-803
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.67e-59
Family ABC transporter ATPase domain-like 0.00000134
Further Details:      
 
Domain Number 3 Region: 8-113
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 3.27e-38
Family DNA repair protein MutS, domain I 0.0000388
Further Details:      
 
Domain Number 4 Region: 114-267
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.57e-35
Family DNA repair protein MutS, domain II 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313204209|ref|YP_004042866.1|
Sequence length 870
Comment DNA mismatch repair protein muts [Paludibacter propionicigenes WB4]
Sequence
MGSDIVETPMMKQFNEIKAKHPDAILLFRCGDFYETFSTDAIQASQILGITLTKRANGAG
KTVELAGFPHHALDTYLPKLVRAGRRVAICDQLEDPKLTKKIVKRGVTELVTPGVSYSDT
TLNHKENTFLASVHLNKNHVGVSFLDISTGEFLVAEGNAEYVDKLLNSFGPKEVLYDRSK
KKDFEAFFGTKFFTYALEDWAYSPDSANERLLKHFEIKNLKGFGVDNLPNGVVAAGAIMH
YLDQTHHQQTGHITQLSRIEEERFVWLDRFTVRNLELYGSINEGARTLLDVIDKTISPMG
ARMLKRWIAFPLKDVKPINERLSVVEHFFKNPDLKLLLEQNVALIGDLERIISKVAVGRI
NPREVVQLKVALKAIEPIKLACSQSDNDTLRKIADQLNACAVISEKIDKEIDNDPPNFIH
RGGVLKSGVDAELDELRQLAYSGKDFLQKIQERESAETGIPSLKISFNNVFGYYIEVRNM
HKDKVPETWIRKQTLVNAERYITQELKVYEEKILGAEEKILSIEIRLFNDLVLSLVDYIT
AIQLDSNLIAQLDCLLSFTRVSSENKYVRPQVTDTDVLEIKQGRHPVIEKQLPIGESYIA
NDVYLDNETQQIIIITGPNMSGKSALLRQTAIITLMAQIGCFVPAESASIGVVDKIFTRV
GASDNISQGESTFMVEMNEAASILNNLSNRSLVLFDELGRGTSTYDGISIAWAIVEYIHE
QVSCKAKTLFATHYHELNEMEKSFHRIKNYNVSVKEVDKKVIFLRKLVRGGSEHSFGIHV
AKMAGMPQSIVKRSEQILKQLETDNRQSGISKPVGEIAEQREGFQLSFFKLDDPVLEQIR
DEIKNLDINNLTPVEALNKLNEVKRIITGK
Download sequence
Identical sequences E4T587
gi|313204209|ref|YP_004042866.1| WP_013445250.1.41328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]