SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313204489|ref|YP_004043146.1| from Paludibacter propionicigenes WB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313204489|ref|YP_004043146.1|
Domain Number 1 Region: 300-447
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 4.87e-24
Family Peptidoglycan hydrolase LytM 0.032
Further Details:      
 
Domain Number 2 Region: 25-177
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000162
Family FCH domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313204489|ref|YP_004043146.1|
Sequence length 449
Comment peptidase m23 [Paludibacter propionicigenes WB4]
Sequence
MHFTLNNRLKVIVLFLMTAVFTLSAQSVKDLEKQRKATLQKLEATSKMLNETNQSKKTSL
NKLNIISKNINERKTLIKNISSEISMMDVQIKKLNDEKQKLESKLEKLKSDYVKLVQEAH
INRSLYARIMFVLSSSSFDQSYRRLRYLQQYSDYRKQQVGEIEQVKTEIVHKNDSINNHK
VTKVEVVKQKEVETKNLSKDEQKEKVLLTDLQKKEKKLREDQKVQQKKAAELNNQIERLI
AEQIRKAEAKRAAAEKKRLAEAKRRAAEEPRYKAKSNTKSSSKSTSEERPTASTTPSSSA
SVSALTKEESLISGNFERNIGRLPWPTSNGFIRGHYGIQPHPVLKFVTTNNKGIYIQTPA
GSNARAVFEGVVTQRFSIPGSNNGVIIQHGNYRTVYANLTQIFVREGDHVSSKQAIGKIY
TDDDENKTELYFQIYNGRNVQNPEHWIAR
Download sequence
Identical sequences E4T617
WP_013445530.1.41328 gi|313204489|ref|YP_004043146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]