SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313205010|ref|YP_004043667.1| from Paludibacter propionicigenes WB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313205010|ref|YP_004043667.1|
Domain Number 1 Region: 154-351
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.96e-54
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000473
Further Details:      
 
Domain Number 2 Region: 436-568
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.02e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000112
Further Details:      
 
Domain Number 3 Region: 20-153
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.42e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.0031
Further Details:      
 
Domain Number 4 Region: 353-430
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.64e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313205010|ref|YP_004043667.1|
Sequence length 578
Comment sulfite reductase (nadph) beta subunit [Paludibacter propionicigenes WB4]
Sequence
MSKDKNIQKESNSVPPQGTGLSSFETLKENSNYLRGTIQESLKDPLTGSIKADDQLLIKF
HGTYQQQDRDLDDERKRQKLEPLYSFLIRVRVPGGVTTAQQWLALDGLADKYADKALKLT
TRQAFQFHGVLKRNLKTTIKEINQSLLDTIAACGDVNRNVMSSANPFESAVHGEVAEDAK
RISAHLTPQTSAYHEIWLDGELVGGGEKDFEPLYGKTYLPRKFKTAIAIPPRNDTDVLSN
DLGFIAIVEKGKLVGYNLTVGGGMAFTFGNNATYPRVADVVGFFPKEKIVDVAEAVLIFQ
RDHGNRSERKNARLKYTIDRLGLDFFRAEIERIKGIKFEPVKPYKFETLGDKYGWTKSED
GLWHYGVFVEGGKLVDKNGYHPKTAIREIAKIHEGTFILTGNQNVVIAQVSETKKPKIEA
ILKKYKVINADKLSSLRQNSIACAALPLCGLAFAEAERYLPTLVDKIDKILEANGLLKTP
ISIRMTGCSNGCGRPFLAEIGLVGKAPGRYNLYLGASFTGERLNKLYKEMLSEEQIVEAL
TPILADYAQSKEAAEHFGDFVIRKGYVKATTHGTNFHD
Download sequence
Identical sequences E4T7I8
WP_013446051.1.41328 gi|313205010|ref|YP_004043667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]