SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313205447|ref|YP_004044104.1| from Paludibacter propionicigenes WB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313205447|ref|YP_004044104.1|
Domain Number 1 Region: 387-595
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-26
Family ABC transporter ATPase domain-like 0.00077
Further Details:      
 
Domain Number 2 Region: 129-187
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000000000183
Family DNA repair protein MutS, domain III 0.015
Further Details:      
 
Weak hits

Sequence:  gi|313205447|ref|YP_004044104.1|
Domain Number - Region: 46-92,189-250
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0837
Family Calcium ATPase, transmembrane domain M 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313205447|ref|YP_004044104.1|
Sequence length 599
Comment DNA mismatch repair protein MutS domain-containing protein [Paludibacter propionicigenes WB4]
Sequence
MTSCSPIAYYQNRITTLEDEYKRLKKRSRMYSLVRFCLFTSFAGSLYLLFKTDYIVLPLI
VAIVSLSFFVLYIVRYNRLEGTIARLSSKIQINRDELLYLDYNFSDRNAGEKYATLNPSL
SADFDLFGKGSLYQYISRCYTQKGSDILAQKLSNPDKDPELIKEKQGAIHELCENNEFVQ
NFLSISRFIQGDVTESVLQGWMDETAKDFTAIRIVAIVLGAVNIVCTLLSAFADVPWTLP
GLTVTISLAFVTFHSKKILKIHSQLISIANHLENYIAAFALTEEQSFQSAHLQSLKKSLT
LNDSTASQTLGALHRILAVFEIRQNKLLSFLLNAFILFDIHLFYSFSHWKLRFNSNTSVW
FGAFHEMETLISFATFAFNNAEHVAYPAISSDGFCVEAQEMGHPLLNQRVRVNNTFSMSG
MPSVLIITGANMAGKSTFLRTVGVNLILGMNGAPVVAESFTFTPCDIFSCLKIQDSLINN
ESYFYAELLRLKEIIEHTQKHPKTLVILDEILRGTNTKDKQTGSLGFLEKLIHLNVPVIV
ATHDLIIGDLEQKYPGIAVNRCFEVELVDDQLYFDYKLKKGVSQKLNASFLLKKMEIID
Download sequence
Identical sequences E4T0Q5
gi|313205447|ref|YP_004044104.1| WP_013446488.1.41328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]