SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317131299|ref|YP_004090613.1| from Ethanoligenens harbinense YUAN-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317131299|ref|YP_004090613.1|
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.00000000000000785
Family Cell division protein ZapA-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317131299|ref|YP_004090613.1|
Sequence length 121
Comment hypothetical protein Ethha_0296 [Ethanoligenens harbinense YUAN-3]
Sequence
MGEKNRVKLKICGNEFYVVSHDSEEYIRAVAEKVEHYLQNLMDRSPTMSTTMAAVFAALE
FCDEAAKATESADNLRAQIKDYLEEAAAAKSEATELRRREIELERENITLRAKVSKLEGG
K
Download sequence
Identical sequences E6U7E7
WP_013484263.1.100024 gi|317131299|ref|YP_004090613.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]