SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317131676|ref|YP_004090990.1| from Ethanoligenens harbinense YUAN-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317131676|ref|YP_004090990.1|
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.00000000000000209
Family YmcA-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317131676|ref|YP_004090990.1|
Sequence length 129
Comment hypothetical protein Ethha_0690 [Ethanoligenens harbinense YUAN-3]
Sequence
MDAIEKAKELVETISRDPRCVRLQAARAAAEADGALQSRIQTWNVRKEQLSTAMRQPVKD
PAALIEQRKALSADYDALMAEPLMAELHTAQSELNGLLMQINNMIQRAVSGEVDADGCGG
DCGGCPGCH
Download sequence
Identical sequences E6U2G8
gi|317131676|ref|YP_004090990.1| WP_013484629.1.100024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]