SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317132904|ref|YP_004092218.1| from Ethanoligenens harbinense YUAN-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317132904|ref|YP_004092218.1|
Domain Number 1 Region: 210-402
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.66e-64
Family B3/B4 domain of PheRS, PheT 0.00000795
Further Details:      
 
Domain Number 2 Region: 472-687
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.44e-40
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00014
Further Details:      
 
Domain Number 3 Region: 42-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.57e-39
Family Myf domain 0.003
Further Details:      
 
Domain Number 4 Region: 697-793
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.75e-26
Family Anticodon-binding domain of PheRS 0.00059
Further Details:      
 
Domain Number 5 Region: 414-480
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000293
Family Domains B1 and B5 of PheRS-beta, PheT 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317132904|ref|YP_004092218.1|
Sequence length 794
Comment phenylalanyl-tRNA synthetase subunit beta [Ethanoligenens harbinense YUAN-3]
Sequence
MKLSMKWLAEHVDVPEGVTPRQFSEDMTMTGQKVEGYETLGEEIRGVVVASILSIEKHPD
SDHLLICRVDAGGPVSVQIVTGAQNVFVGALVPAALDGALLPGGKRINSGKLRGVMSDGM
LCSLGELGLSQADFPYAAEDGIFILREDCAPGEDIRKAVGLDDVVVEFEITPNRPDCLSV
IGLAREAAATYRKLRRVHVPAVRGGAGKTSDLLSAQIDAPELCTRYCARAVKQVCIKPSP
RWMRERLRAAGVRPINNIVDITNYVMLEYGQPLHAFDVRSIAGGAIRVRRAEEGERITTL
DGVEHALDPSICVIADTEKPVAVAGVMGGECSGILPDTHTIVFESAMFSGPDVRLAAKKL
GLRTEASARFEKGLNAAATPVALARACELVELLDAGVVCDDALDIDRSAKTETTVALDPN
WINAFLGTSLSPVFMEDALKRLEFTVRDGVVHVPSFRADVEHKADVAEEVARIYGYNQIP
VTVTLGATTQGGLNAKQRFEKRMGEVARAAGLSGIETYSFLSPRACDLIRLPAGDPMRNS
VRISNPLGEETSILRTTLLPSMLDVLARNYAARNLEAALYEAGTVYLPEVGQELPDERQK
IEIGLYGEGTDYFTLKGAVEAILAGAGIDAFDVERVTDLPYYHPGRCARILAGGEELALL
GEVHPQVLENYEIGVRAYAAEIDFATLFAHARTSAEYHPLPKFPATTRDIAVLCDASVPV
LTLEKAMRGAAKDKLESIHLFDVYQGQQIEAGKKSVAFSVTLRVADHTLTDREADAAVQK
MLAALEQAGAVLRV
Download sequence
Identical sequences E6U2U5
WP_013485835.1.100024 gi|317132904|ref|YP_004092218.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]