SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317133212|ref|YP_004092526.1| from Ethanoligenens harbinense YUAN-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317133212|ref|YP_004092526.1|
Domain Number 1 Region: 5-231
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.28e-57
Family PP-loop ATPase 0.0000749
Further Details:      
 
Domain Number 2 Region: 355-440
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.39e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0071
Further Details:      
 
Weak hits

Sequence:  gi|317133212|ref|YP_004092526.1|
Domain Number - Region: 208-304
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00068
Family MesJ substrate recognition domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317133212|ref|YP_004092526.1|
Sequence length 457
Comment tRNA(Ile)-lysidine synthetase [Ethanoligenens harbinense YUAN-3]
Sequence
MQARDTMKTYHLLAPGDAVLAAFSGGADSTALLHLLCALREEWGLRVFAAHLNHGLRGEE
ADRDEAFVRARCVEWGVPCFVRRTDVRAEAARTGESEELCGRRLRYAFFAEQAEALGAKI
ATAHTLSDSVETMLLNLARGTGLAGLRGIPPVRGNIVRPLIETTRAEVEVYCAAHGLNYV
TDSTNFSRAYGRNRIRLDVVPALRALNPALERTLARDMRLFARDEAVLEDLTASLLRAAA
VPGGFAAEVLRASPLCARALAAAAAQTTGLRPEAVHVRAMEQLLRTGAGRTQLRGGWFAE
IVRGVLSFSPGKEEPPAPFCRPLAPGVLENGPVRLKVTPVEHANVKKFESFCARYFKSVL
DCDKIIGKAVIRTRRAGDFYHPAGRGVGKSLKKLFNEQAVPPSLRPYVPVAADETGIIWV
GGFGPDARCAPDTGTRRVLFLAYDADTRKGATGDGGY
Download sequence
Identical sequences E6U4R0
gi|317133212|ref|YP_004092526.1| WP_013486143.1.100024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]