SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317133484|ref|YP_004092798.1| from Ethanoligenens harbinense YUAN-3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|317133484|ref|YP_004092798.1|
Domain Number - Region: 5-101
Classification Level Classification E-value
Superfamily FlgN-like 0.00127
Family FlgN-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317133484|ref|YP_004092798.1|
Sequence length 145
Comment hypothetical protein Ethha_2574 [Ethanoligenens harbinense YUAN-3]
Sequence
MQRFKFRLAPVRNLRQYAEREQKDVLAREQHALRLLEQEAEALREAERQWSARYLRVCGA
GAVPAEMMRIQSYLAELRARRKDNAARIREQTETVEQARELLMTKMQARKTIDALYEKQI
RLYHREQKIQTEKEIEEQIAARLHW
Download sequence
Identical sequences E6U6J7
gi|317133484|ref|YP_004092798.1| WP_013486410.1.100024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]