SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317133630|ref|YP_004092944.1| from Ethanoligenens harbinense YUAN-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317133630|ref|YP_004092944.1|
Domain Number 1 Region: 27-117,249-465
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.45e-87
Family Bacterial dinuclear zinc exopeptidases 0.000000511
Further Details:      
 
Domain Number 2 Region: 118-248
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 6.59e-33
Family Aminopeptidase/glucanase lid domain 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317133630|ref|YP_004092944.1|
Sequence length 467
Comment peptidase M18 aminopeptidase I [Ethanoligenens harbinense YUAN-3]
Sequence
MAEKEKTEAQKLKDALFYKPQNGAKTYTPEQTAQADVFGERYKAFLDEAKMEREAVAYAV
REAQANGFVPFEKGKTYAPGDKVYTVNRGKAAIFAVFGTRPLTEGVRIAAAHIDSPRLDL
KQNPLYEDTDLALFKTHYYGGIKKYQWTAIPLALHGVIVKKDGAVVQVKVGEDAGEPLFC
VTDLLPHLAREQMKKPMTEFGAEKLNVLIGSRPFKDDKESELVKLNILRLLNEKYGVVES
DFLSAELAMVPAFKSVDIGFDRSLIGAYGHDDRVCAYTAFTALLDSSAPAQTAVCVLADK
EEIGSEGSTGLQSAFLSYFITDLAELSGLEGRDVLTASKCLSADVNAAFDPTYPDVMEKK
NASYVNHGVVLSKFTGHGGKYDTNDASAEFTAEVIRLLDANGILWHMAELGKVDQGGGGT
VAKYIGDLNVDVIDVGVPVLSMHAPFEIVSKIDVYEAYRAFSVFYTA
Download sequence
Identical sequences E6U7U0
WP_013486556.1.100024 gi|317133630|ref|YP_004092944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]