SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328957311|ref|YP_004374697.1| from Carnobacterium sp. 17-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328957311|ref|YP_004374697.1|
Domain Number 1 Region: 17-177
Classification Level Classification E-value
Superfamily RNase III domain-like 7.85e-50
Family RNase III catalytic domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 171-243
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 8.96e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|328957311|ref|YP_004374697.1|
Sequence length 245
Comment ribonuclease III [Carnobacterium sp. 17-4]
Sequence
MKEHGEIFIERKNTMDDAFLTQLKTKFDLVFHDLSYLEEAFTHSSYVNEHRNLELKDNER
IEFLGDAVLELTVSRFLYELYPNLPEGKLTRLRATIVCEASLSQFAKEYEFDQFIRLGRG
EERMNGRKRPALLCDLFESFIGALYLDQGIDSVLSFLDQTIFPKIKSGAFSHVMDHKTNL
QEFLQQKGEIGIDYQLVDEIGPAHQKAFVVEVLAEGQVLGQGQGKTKKAAEQVAAENALL
ALQEK
Download sequence
Identical sequences F4BPZ6
gi|328957311|ref|YP_004374697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]