SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC01G08400.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC01G08400.1
Domain Number 1 Region: 533-626
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000595
Family Tropomyosin 0.0025
Further Details:      
 
Domain Number 2 Region: 352-627
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OPUNC01G08400.1
Sequence length 790
Comment pep:novel chromosome:AVCL00000000:1:6898036:6902655:-1 gene:OPUNC01G08400 transcript:OPUNC01G08400.1 description:""
Sequence
MPPVLLVWPTGLCPTHAGHITTSWRLRLRHTAAPDESARKTVTKTSPPTSSRWRTINQIP
RLASHLIATPTHGRRACDRASELDGVRLSLSLSAPRREIDTLKTKKKARDHMDTESIQDG
GDYLRENILLSGEDDRNGESIAEIQTRVDLGIAFGSEKLLNLEMLLMEIAHRATEIEPLM
LDAESISTESVKRVSEFDLLHCILDSEVKELEKLVDSIEVDIGNAEKMVDSDEDSASEVN
SKLQDAAVSLNQMQDLISAIRRQSANFEKVIDPSHDNSGASEDGGYENGHVSSRSAVPAE
EQRNTLQMLNQSIASELDLGKKLHDSESVMEELKLKLHHVEHESYFLEESVEAISERMFA
AENASELFLGASKELIGKVNTIQFHLSASIRREGDLKSKLEQSLTESNGSNSTLENMKQD
TEKVIWEAMPSQAQPDSEFLNLQDKIQHLEEWMRESKSGLPLTIASTGPNEVDKAQNMPR
SEMSTFENIVSDIKDAVFRAESRTQNAEAQCKQLSHTNIQLDEELKSLKSQGSDRAGLLE
EKLKESETQLQHAKASIEAIVEQHSMFKSSMSDMEQVIDDLKEKYLKAETRAENAESKCT
LLTDTNLELSEELSFLRGRVESLENSLCRANQLKMSAAKYIGIKTKTITDLVAKLALERE
RLHLQIVTLTKKNRVLVQKCKENINEVTLLSNKVTASEDELKTTKVMEKIVPDYSPTRTK
VKRTADTLGEEEDEITAAPEDNSGACSTPDTVRSIEPKILNWKWIFAAFLVLLAAVLLFF
GHKLGKASGL
Download sequence
Identical sequences A0A0E0JG33
OPUNC01G08400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]