SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC01G40220.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC01G40220.1
Domain Number 1 Region: 537-581
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000184
Family B3 DNA binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OPUNC01G40220.1
Sequence length 678
Comment pep:novel chromosome:AVCL00000000:1:42687900:42691546:-1 gene:OPUNC01G40220 transcript:OPUNC01G40220.1 description:""
Sequence
MDASAGSSAPHSHGNPGKQGGGGGRGKAPAAEIRGEAARRDDIFFADDTFPSLPDFPCLS
SPSSSTFSSSSSSNSSSAFTTAAGGGCGGGGGGEPSEPASAADGFDELADIDQLLDLASL
SVPWEAEQPLFPDDVGMMIEDAISGQPHQADDCTGDAKAVLEVAGGGEDAGDACMGTDEP
DDLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQN
HHLQKKRARTAIDGAASSDPQLPSPGANPGYEFPSGGQEMGSAAATSWMPYQAFTPPAAY
GCDAMYPGAAGQFPFQQSCSTSSVVVNSQPFSPPTAAATAADMHASSGGNMAWPQQFAPF
PVSSTSSYTMPSVVPPPFTAGFPGQYSGGHGMCSPRLTGVEPSSTKEARKKRMARQRRLS
CLQQQRSQQINLSQIQISGHPQDPSPCAAHSAPVTPSSAGCRSWGIWPPAGQIIQNPLSN
KPNPPLATSKQPKPSPEKPKPKPQAAAVAGAESPQRATASEKRQQAATRTDKNLRFLLQK
VLKQSDVGSLGRIVLPKKEAEVHLPELKTRDGISIPMEDIGTSQLIRGVKVRRAAQEQGN
NSSGAVGKHKHGSPEKAGISNTKAAGADDGAGGDDNADAAAAGKPDGGGCKGKSPHGVRR
SRQLEAASASMSQMAVSI
Download sequence
Identical sequences A0A0E0JSL2
OPUNC01G40170.1 OPUNC01G40220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]