SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC01G42830.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC01G42830.1
Domain Number 1 Region: 295-379
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.78e-19
Family Ankyrin repeat 0.00099
Further Details:      
 
Domain Number 2 Region: 9-53,93-178
Classification Level Classification E-value
Superfamily POZ domain 2.04e-17
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OPUNC01G42830.1
Sequence length 503
Comment pep:novel chromosome:AVCL00000000:1:44600282:44603001:-1 gene:OPUNC01G42830 transcript:OPUNC01G42830.1 description:""
Sequence
MEETLKSLSMDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGAAADQA
AAPGALLLDHLSPRSPSAASASSPRGAGGSAAAAAAATPGAVIPVSSVSYEVFLLLLQFL
YSGQVSLVPQKGEPRPGCGERGCWHTHCAAAVDLALDTLAAARSFGVEELALLTQKQLAG
MVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIDELRL
KSMSRRSPFLSHHHPHHPAGIETSAAELDDHHKIRRMRRALDSSDVELVKLMVMGEGLNL
DEALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVAVLLDHH
ADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAAMVMSREDA
QTAVNAAPIYGESPGGGGGGGGVYNASGTSSSMVNLSLDNRMVYLNLGMDAQFGKMNDGS
DGDDGGSRGHGGPSSLFSPHGFP
Download sequence
Identical sequences A0A0E0JTL1
OPUNC01G42830.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]