SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC03G23950.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC03G23950.1
Domain Number 1 Region: 23-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-23
Family B3 DNA binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 434-537
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-17
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 3 Region: 257-342
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000824
Family B3 DNA binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OPUNC03G23950.1
Sequence length 544
Comment pep:novel chromosome:AVCL00000000:3:25557070:25559772:1 gene:OPUNC03G23950 transcript:OPUNC03G23950.1 description:""
Sequence
MAGSGSCMKKSCVCCQRYLEHLGGKMSCFLRRMTASSRRSMIMPYKFVNHFGGDVSGTIK
LQSPNGILYVVEVTECKNKTVLKCGWEAFVDAHHIEENDSLLFRHIENSHFEVLIFDSDD
CEKVFSCAGIGNTCNSIQEKSSSSCDDTAESSESEGFARNQKGSFSHRRRTANLASSSED
SGKSFVKLFAYMLNFGKIRIIILKFLVKFCTGEDSPSEHESVESGDLETSQEPYVLSRRT
YLSEIQKEKVDALIQEIQPETTVFVAIMRRSNVQLPTPFLRPCKSKKWHPRFYKRKDARM
NILRGSWVEFVKDNRVQEQDICVFVPAKDARRNFTFTVHLLRLAAAYSWGGTGVDRASSS
LGRTDVKSASEISIKEEPIDQEENVSSKNRNGVSDESEEDEDSKGPADPPYIVPCKSRLS
QLQKKIVEEKVRSIQSKLPVYVAIMKKSNVERTASRCQLELGARFAAAVRLPDRRQTVVL
QRMGERWATVMQIRSRTRRLLITGWHRFVRDNHLRVGDICLLELKTHERRLTMAVHPIFR
EHCC
Download sequence
Identical sequences A0A0E0KGC9
OPUNC03G23950.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]